Product Name:

GABA-B Receptor 2


Product Number:

ab-nn256-2

Price:

Regular price
$105.00
Regular price
Sale price
$105.00

Download Product PDF

Target Full Name: Gamma-aminobutyric acid type B receptor subunit 2

Target Alias: BcDNA:GH07312; CG6706; CT20836; D GABA[[B]]R2; D Gaba2; FLJ36928; G protein coupled receptor 51; G protein coupled receptor 51; GAB B R2; GABA B R2; GABA B receptor 2; GABA B RECEPTOR; GABA-B receptor 2; GABA-B-R2; GABA-BR2; GABA[[B]]R2; GABAB R2; GABABR 2; GABABR2; GABB R2; GABBR 2; GABBR2; GABR2_HUMAN; Gamma aminobutyric acid (GABA) B receptor 2; Gamma aminobutyric acid B receptor 2; Gamma aminobutyric acid GABA B receptor 2; Gamma aminobutyric acid type B receptor subunit 2; Gamma-aminobutyric acid type B receptor subunit 2; Gb 2; Gb2; GH07312; GPR 51; GPR51; GPRC 3B; GPRC3B; HG 20; HG20; HRIHFB2099; Metabotropic GABA B receptor subtype 2; OTTHUMP00000021776; OTTHUMP00000063797; R2 SUBUNIT

Product Type Specific: Chloride channel pan-specific antibody

Antibody Code: NN256-2

Antibody Target Type: Pan-specific

Protein UniProt: O75899

Protein SigNET: GABA-B Receptor 2

Antibody Type: Monoclonal

Antibody Host Species: Mouse

Antibody Ig Isotype Clone: IgG1

Antibody Immunogen Source: Fusion protein with rat GABA(B)R2 peptide (Uniprot ID O88871)

Antibody Immunogen Sequence: PQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILHHAYLPSIGGVDAS

Antibody Immunogen Description: Corresponds to amino acid residues N861-A912.

Production Method: Protein G purified

Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.

Antibody Concentration: 1 mg/ml

Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide

Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.

Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence

Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.

Antibody Potency: In mouse brain lysates, this antibody detects a ~105 kDa protein by Western blotting.

Antibody Species Reactivity: Human | Chimpanzee | Rhesus macaque | Dog | Rat | Mouse

Antibody Positive Control: 1 µg/ml of SMC-402 was sufficient for detection of GABA(B)R2 in 20 µg of rat brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.

Antibody Specificity: Very high

Antibody Cross Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Chimpanzee | Rhesus macaque | Dog | Rat | Mouse.

Scientific Background: GABA (γ-aminobutyric acid) is the primary inhibitory neurotransmitter in the central nervous system, and it reduces the ability of nerve cells to send or receive chemical messages, producing a calming effect to counteract anxiety, stress and fear. This small molecule interacts with three different receptors: GABA(A), GABA(B) and GABA(C) receptors. The ionotropic GABA(A) and GABA(C) receptors are ligand-gated ion channels that produce fast inhibitory synaptic transmission. In contrast, the metabotropic GABA(B) receptor is coupled to G proteins that modulate slow inhibitory synaptic transmission (1). Functional GABA(B) receptors form heterodimers of GABA(B)R1 and GABA(B)R2 where GABA(B)R1 binds the ligand and GABA(B)R2 is the primary G protein contact site (2). Two isoforms of GABA(B)R1 have been cloned: GABA(B)R1a is a 130 kDa protein and GABA(B)R1b is a 95 kDa protein (3). G proteins subsequently inhibit adenyl cylase activity and modulate inositol phospholipid hydrolysis. GABA(B) receptors have both pre- and postsynaptic inhibitions: presynaptic GABA(B) receptors inhibit neurotransmitter release through suppression of high threshold calcium channels, while postsynaptic GABA(B) receptors inhibit through coupled activation of inwardly rectifying potassium channels. In addition to synaptic inhibition, GABA(B) receptors may also be involved in hippocampal long-term potentiation, slow wave sleep and muscle relaxation (1). This description may include information annotated by UniProt and/or Google AI.