Product Name:
GABA-A Receptor Epsilon
Product Number:
ab-nn255-1
Target Full Name: Gamma-aminobutyric acid receptor subunit epsilon
Target Alias: Gamma-aminobutyric acid receptor epsilon subunit; GABRE
Product Type Specific: GABRE chloride channel pan-specific antibody
Antibody Code: NN255-1
Antibody Target Type: Pan-specific
Protein UniProt: P78334
Protein SigNET: GABA-A Receptor Epsilon
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG2A
Antibody Immunogen Source: Fusion protein with extracellular N-terminus of human GABA-A receptor epsilon
Antibody Immunogen Sequence: SKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEISVNSLGPLSILDMEYTIDIIFSQTWYDERLCYNDTFESLVLNGNVVSQLWIPDTFFRNSKRTHEHEITMPNQMVRIYKDGKVLYTIRMTIDAGCSLHMLRFPMDSHSCPLSFSSFSYPENEMIYKWENFKLEINEKNSWKLFQFDFTGVSNK
Antibody Immunogen Description: Corresponds to amino acid residues S27-K253.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.1% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: In mouse brain lysates, this antibody detects a ~60 kDa protein by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Chimpanzee | Rhesus macaque | Rat.
Antibody Positive Control: A 1:100 dilution of SMC-493 was sufficient for detection of GABA-A R, Epsilon in 20 µg of mouse brain lysate by ECL immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Related Product 1: GABA-A Receptor Alpha2 expression antibody (Cat. No.: AB-NN250-1)
Related Product 2: GABA-A Receptor Alpha4 expression antibody (Cat. No.: AB-NN251-1)
Related Product 3: GABA-A Receptor Alpha5 expression antibody (Cat. No.: AB-NN252-1)
Related Product 4: GABA-A Receptor Beta1 expression antibody (Cat. No.: AB-NN253-1)
Related Product 5: GABA-A Receptor Beta3 expression antibody (Cat. No.: AB-NN254-1)
Related Product 6: GABA-B Receptor 2 expression antibody (Cat. No.: AB-NN256-2)
Related Product 7: GABARAP expression antibody (Cat. No.: AB-NN257-1)
Related Product 8: GABARAP expression antibody (Cat. No.: AB-NN257-2)
Related Product 9: GABARAPL1 expression antibody (Cat. No.: AB-NN258-1)
Related Product 10: GABA B Receptor 1 expression antibody (Cat. No.: AB-NN259-1)
Scientific Background: GABRE is an eplison subunit of the heteropentameric ligand-gated chloride channel gated by gamma-aminobutyric acid (GABA). The GABA-A receptor is a member of the superfamily of fast acting ligand-gated ion channels. The individual subunits of these receptors have similar sequences and structural features (1). GABA-A receptors are the major fast inhibitory neurotransmitter gated ion channels in the brain (2). GABAARs containing epsilon subunits also permit spontaneous chloride channel activity while preserving the structural information required for GABA-gated openings. It forms GABA-activated chloride channels to inhibit or reduce neuronal activity. The inclusion of the epsilon-subunit can alter receptor rectification, deactivation, and spontaneous openings. GABARs containing epsilon subunit may regulate cardiac function. It is highly expressed in the heart and placenta, with specific roles in the brain. GABRE is lnked to X-linked mental retardation (MRX3) and early-onset parkinsonism (Waisman syndrome). Increased expression of GABRE is reported in the lateral cerebellum in schizophrenia, bipolar disorder, and major depression. The GABRE gene locus is often hypermethylated and downregulated in prostate cancer, indicating a potential tumor-suppressive role in conjunction with adjacent microRNAs. This description may include information annotated by UniProt and/or Google AI.