Product Name:
GABA-A Receptor Beta3
Product Number:
ab-nn254-1
Target Full Name: Gamma-aminobutyric acid receptor subunit beta-3
Target Alias: ECA5; GABA alpha receptor beta-2 subunit; GABA(A) receptor subunit beta-3; GABAA receptor beta 3 subunit; GABAA receptor subunit beta 3; GABR B3; Gabrb3; Gamma aminobutyric acid (GABA) A receptor beta 3; Gamma aminobutyric acid receptor subunit beta 3; Gamma-aminobutyric acid receptor subunit beta-3; GBRB3_HUMAN; MGC9051 antibody
Product Type Specific: GABRB3 chloride channel pan-specific antibody
Antibody Code: NN254-1
Antibody Target Type: Pan-specific
Protein UniProt: P28472
Protein SigNET: GABA-A Receptor Beta3
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with mouse GABA-A-R-Beta3 peptide
Antibody Immunogen Sequence: TSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRSLPHKKTHLRRRSS
Antibody Immunogen Description: Corresponds to amino acid residues T370-S433.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000), IHC (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.
Antibody Potency: Detects a ~55 kDa protein in cell and tissue lysates by Western blotting.
Antibody Species Reactivity: Human | Chimpanzee | Rhesus macaque | Rat | Mouse
Antibody Positive Control: 1 µg/ml of SMC-339 was sufficient for detection of Beta3 GABA receptor in 10 µg of rat brain lysate by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Cross Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Chimpanzee | Rhesus macaque | Rat | Mouse.
Related Product 1: GABA-A Receptor Alpha2 expression antibody (Cat. No.: AB-NN250-1)
Related Product 2: GABA-A Receptor Alpha4 expression antibody (Cat. No.: AB-NN251-1)
Related Product 3: GABA-A Receptor Alpha5 expression antibody (Cat. No.: AB-NN252-1)
Related Product 4: GABA-A Receptor Beta1 expression antibody (Cat. No.: AB-NN253-1)
Related Product 5: GABA-A Receptor Epsilon expression antibody (Cat. No.: AB-NN255-1)
Related Product 6: GABA-B Receptor 2 expression antibody (Cat. No.: AB-NN256-2)
Related Product 7: GABARAP expression antibody (Cat. No.: AB-NN257-1)
Related Product 8: GABARAP expression antibody (Cat. No.: AB-NN257-2)
Related Product 9: GABARAPL1 expression antibody (Cat. No.: AB-NN258-1)
Related Product 10: GABA B Receptor 1 expression antibody (Cat. No.: AB-NN259-1)
Scientific Background: GABRB3 is a beta subunit of the heteropentameric ligand-gated chloride channel gated by gamma-aminobutyric acid (GABA). GABA-gated chloride channels (GABA(A) receptors (GABAAR)), consist of five subunits arranged around a central pore and contain one or two GABA active binding sites located at the alpha and beta subunit interfaces, depending on subunit composition. The individual subunits of these receptors have similar sequences and structural features (1). GABA-A receptors are the major fast inhibitory neurotransmitter gated ion channels in the brain (2). When activated by GABA, GABAARs selectively allow the flow of chloride anions across the cell membrane. Beta-containing GABAARs can simultaneously bind GABA and histamine where histamine binds at the interface of two neighboring beta subunits, which has been implicated the regulation of sleep and wakefulness. GABAARs containing beta-3/GABRB3 subunit are found at both synaptic and extrasynaptic sites. GABRB3 is particularly important in early development, with high expression in the fetal brain, and it plays a significant role in inhibitory neurotransmission in the adult hippocampus. Mutations or reduced expression of GABRB3 are associated with several neurodevelopmental and neurological disorders, including autism spectrum disorders, epilepsy, and Angelman syndrome. This description may include information annotated by UniProt and/or Google AI.