Product Name:
SUR2A
Product Number:
ab-nn341-1
Target Full Name: ATP-binding cassette sub-family C member 9
Target Alias: ABC36; Abcc8; ABCC8_HUMAN; ATP binding cassette sub family C (CFTR/MRP) member 8; ATP binding cassette transporter sub family C member 8 (1); ATP-binding cassette sub-family C member 8; HHF1; HI; HRINS; MRP8; PHHI; Sulfonylurea receptor (hyperinsulinemia); Sulfonylurea receptor 1; SUR; SUR1; SUR1delta2; TNDM2; ABC37; abcC9; ABCC9_HUMAN; AI414027; AI449286; ATFB12; ATP-binding cassette transporter sub-family C member 9; ATP-binding cassette; sub-family C (CFTR/MRP); member 9; CANTU; CMD1O; FLJ36852; Sulfonylurea receptor 2; Sulfonylurea-binding protein 2; SUR2; SUR2A; SUR2B
Product Type Specific: ABC protein pan-specific antibody
Antibody Code: NN341-1
Antibody Target Type: Pan-specific
Protein UniProt: O60706
Protein SigNET: SUR2A
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG2A
Antibody Immunogen Source: Fusion protein with cytoplasmic C-terminus of mouse SUR2A (Uniprot ID Q63563-1)
Antibody Immunogen Sequence: SIMDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK
Antibody Immunogen Description: Corresponds to amino acid residues S1505-K1546.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: In mouse brain lysates, this antibody detects a ~120 kDa protein by Western blotting.
Antibody Species Reactivity: Human | Rat | Mouse
Antibody Positive Control: 1 µg/ml of SMC-431 was sufficient for detection of SUR2A in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: High
Antibody Cross Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rat | Mouse.
Related Product 1: SUR1 pan-specific antibody (Cat. No.: AB-NN340-1)
Related Product 2: SUR1 and SUR2B pan-specific antibody (Cat. No.: AB-NN340-2)
Scientific Background: Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2). This description may include information annotated by UniProt and/or Google AI.

