Product Name:
SUR1
Product Number:
ab-nn340-1
Target Full Name: ATP-binding cassette sub-family A member 10
Target Alias: ABCA10; ABCAA; ATP binding cassette subfamily A member 10; ATP-binding cassette A10; ATP-binding cassette sub-family A member 10; ATP-binding cassette, sub-family A (ABC1), member 10; ATP-binding cassette, sub-family A, member 10; EST698739
Product Type Specific: ABC protein pan-specific antibody
Antibody Code: NN340-1
Antibody Target Type: Pan-specific
Protein UniProt: Q8WWZ4
Protein SigNET: SUR1
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with cytoplasmic C-terminus of rat SUR1 (Uniprot ID Q09429)
Antibody Immunogen Sequence: LVMVLKRGAILEFDKPEKLLSQKDSVFASFVRADK
Antibody Immunogen Description: Corresponds to amino acid residues L1548-K1582.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000), IHC (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.
Antibody Potency: In mouse brain lysates, this antibody detects a ~160 kDa protein by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Rat | Mouse | Hamster.
Antibody Positive Control: 1 µg/ml of SMC-409 was sufficient for detection of SUR1 in 20 µg of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Antibody Cross Reactivity: Does not cross-react with SUR2B.
Related Product 1: SUR1 and SUR2B pan-specific antibody (Cat. No.: AB-NN340-2)
Related Product 2: SUR2A pan-specific antibody (Cat. No.: AB-NN341-1)
Scientific Background: Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2) (1). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell (2). This description may include information annotated by UniProt and/or Google AI.