Product Name:
TrpM7
Product Number:
ab-nk305-1
Target Full Name: Transient receptor potential cation channel subfamily M member 7
Target Alias: CHAK; CHAK1; Channel kinase 1; Channel-kinase 1; Long transient receptor potential channel 7; LTrpC-7; LTRPC7; TRP PLIK; TRPM7; TRPM7_HUMAN antibody
Product Type Specific: CHAK1 (TRPM7) protein kinase pan-specific antibody
Antibody Code: NK305-1
Antibody Target Type: Pan-specific
Protein UniProt: Q96QT4
Protein SigNET: TrpM7
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with C- terminus of mouse TrpM7 (Uniprot ID Q923J1)
Antibody Immunogen Sequence: LKLPDLKRNDYTPDKIIFPQDESSDLNLQSGNSTKESEATNSVRLML
Antibody Immunogen Description: Corresponds to amino acid residues L1817-L1863.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence | Immunoprecipitation
Antibody Dilution Recommended: WB (1:1000), IHC (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.
Antibody Potency: Detects a ~220 kDa protein in cell and tissue lysates by Western blotting.
Antibody Species Reactivity: Human | Rat | Mouse
Antibody Positive Control: 1 µg/ml of SMC-316 was sufficient for detection of TrpM7 in 10 µg of COS cell lysate transiently transfected with TprM7 by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Antibody Cross Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rat | Mouse.
Related Product 1: TrpC5 pan-specific antibody (Cat. No.: AB-NN350-1)
Related Product 2: TrpC7 pan-specific antibody (Cat. No.: AB-NN351-1)
Related Product 3: TrpV3 pan-specific antibody (Cat. No.: AB-NN353-1)
Scientific Background: TRPs, mammalian homologs of the Drosophila transient receptor potential (trp) protein, are ion channels that are thought to mediate capacitative calcium entry into the cell. TRP-PLIK is a protein that is both an ion channel and a kinase. As a channel, it conducts calcium and monovalent cations to depolarize cells and increase intracellular calcium. As a kinase, it is capable of phosphorylating itself and other substrates. The kinase activity is necessary for channel function, as shown by its dependence on intracellular ATP and by the kinase mutants (1, 2). K1648R and G1799D mutations lead to loss of activity for this atypical protein-serine/threonine kinase and are associated with amyotrophic lateral sclerosis-parkinsonism/dementia complex 1 (ALS-PDC1), which is characterized by chronic, progressive and uniformly fatal amyotrophic lateral sclerosis and parkinsonism-dementia. This description may include information annotated by UniProt and/or Google AI.