Product Name:
Synaptotagmin-6
Product Number:
ab-nn367-1
Target Full Name: Synaptotagmin-6
Target Alias: SYT-6; SYT6; Synaptotagmin VI; SytVI; Syt VI; Synaptotagmin6; SynaptotagminVI
Product Type Specific: Synaptic protein pan-specific antibody
Antibody Code: NN367-1
Antibody Target Type: Pan-specific
Protein UniProt: Q5T7P8
Protein SigNET: Synaptotagmin
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein from cytoplasmic C2A domain of mouse Synaptotagmin-6 (Uniprot ID Q9R0N8)
Antibody Immunogen Sequence: TLIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHFPVPYEELADRKLHLSVFDFDRFSRHDMIGEVI
Antibody Immunogen Description: Corresponds to amino acid residues T246-I333.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: Detects a ~55 kDa protein in cell and tissue lysates by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rat | Mouse.
Antibody Positive Control: 1 µg/ml of SMC-425 was sufficient for detection of Synaptotagmin-6 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Cross Reactivity: Does not cross-react with other synaptotagmins.
Related Product 1: Synaptophysin pan-specific antibody (Cat. No.: AB-NN370-1)
Related Product 2: Synaptotagmin-3 pan-specific antibody (Cat. No.: AB-NN366-1)
Related Product 3: Synaptotagmin-7 pan-specific antibody (Cat. No.: AB-NN342-1)
Related Product 4: Synaptotagmin-9 pan-specific antibody (Cat. No.: AB-NN343-1)
Related Product 5: Synaptotagmin-10 pan-specific antibody (Cat. No.: AB-NN344-1)
Related Product 6: Synaptotagmin-12 pan-specific antibody (Cat. No.: AB-NN345-1)
Scientific Background: Synaptotagmins constitute a family of membrane-trafficking proteins that are characterized by an N-terminal transmembrane region (TMR), a variable linker, and two C-terminal C2 domains - C2A and C2B. There are 15 members in the mammalian synaptotagmin family. There are several C2-domain containing protein families that are related to synaptotagmins, including transmembrane (Ferlins, E-Syts, and MCTPs) and soluble (RIMs, Munc13s, synaptotagmin-related proteins and B/K) proteins. The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Calcium binding to synaptotagmin participates in triggering neurotransmitter release at the synapse. The first domain mediates Ca(2+)-dependent phospholipid binding. The second C2 domain mediates interaction with Stonin 2. Synaptotagmin may have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacylbackbone. A Ca(2+)-dependent interaction between synaptotagmin and putative receptors for activated protein kinase C has also been reported. It can bind to at least three additional proteins in a Ca(2+)-independent manner; these are neurexins, syntaxin and AP2. This description may include information annotated by UniProt and/or Google AI.

