Product Name:
VGLUT3
Product Number:
ab-nn362-1
Target Full Name: Vesicular glutamate transporter 3
Target Alias: DFNA25; deafness autosomal dominant 25; SLC17A8; Solute carrier family 17 member 8; VGLUT 3; Solute carrier family 17 (sodium dependent inorganic phosphate cotransporter) member 8
Product Type Specific: Solute carrier protein pan-specific antibody
Antibody Code: NN362-1
Antibody Target Type: Pan-specific
Protein UniProt: Q8NDX2
Protein SigNET: VGLUT3
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with cytoplasmic C-terminus of rat VGlut3 (Uniprot ID Q7TSF2)
Antibody Immunogen Sequence: MSYGATTQNCEVQKTDRRQQRESAFEGEEPLSYQNEEDFSETS
Antibody Immunogen Description: Corresponds to amino acid residues M546-S588.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: In mouse brain lysates, this antibody detects a ~65 kDa protein by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Rat | Mouse.
Antibody Positive Control: 1 µg/ml of SMC-397 was sufficient for detection of VGLut3 in 20 µg of CV-1 fibroblast cells (lysate) transfected with VGlut3 by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Related Product 1: VGLUT1 pan-specific antibody (Cat. No.: AB-NN361-1)
Related Product 2: VGLUT2 pan-specific antibody (Cat. No.: AB-NN323-1)
Scientific Background: VGLUT3 (Vesicular Glutamate Transporter 3) is a 60-62 kDa multipass membrane protein restricted to synaptic vesicles of glutamergic neurons. It is specifically expressed in amygdala, cerebellum, hippocampus, medulla, spinal cord, and thalamus. It functions as a proton-driven pump (uniporter) using the electrochemical gradient created by v-ATPase to fill vesicles with glutamate. It is responsible for packing the excitatory neurotransmitter glutamate into synaptic vesicles. Unlike its counterparts VGLUT1 and VGLUT2, which are found in traditional excitatory neurons, VGLUT3 is considered an "atypical" transporter, largely expressed in cells that typically utilize other neurotransmitters (e.g., serotonin, acetylcholine, or GABA). VGLUT3 plays a critical role in modulating behavior, specifically in anxiety, depression, social interaction, and motor control. Human VGLUT3 shares a 72% sequence homology with VLGUT2 and BNPI. Impairment or mutation in the SLC17A8 gene is linked to non-syndromic deafness DFNA25. Mice lacking VGLUT3 are viable but exhibit increased anxiety-associated behaviors and, in some models, improved motor function in Parkinson's models. This description may include information annotated by UniProt and/or Google AI.