Product Name:
VGLUT1
Product Number:
ab-nn361-1
Target Full Name: Vesicular glutamate transporter 1
Target Alias: BNPI; SLC17A1; SLC17A1/VGLUT1; Solute Carrier family 17 member 7; VGLUT 1; Brain-specific Na(+)-dependent inorganic phosphate cotransporter
Product Type Specific: VGLUT1 solute carrier protein pan-specific antibody
Antibody Code: NN361-1
Antibody Target Type: Pan-specific
Protein UniProt: Q9P2U7
Protein SigNET: VGLUT1
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with cytoplasmic C-terminus of rat VGlut1 (Uniprot ID Q62634)
Antibody Immunogen Sequence: EKQPWAEPEEMSEEKCGFVGHDQLAGSDESEMEDEVEPPGAPPAPPPSYGATHSTVQPPRPPPPVRDY
Antibody Immunogen Description: Corresponds to amino acid residues E493-Y560.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: Detects a ~52 kDa protein in cell and tissue lysates by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rat | Mouse.
Antibody Positive Control: 1 µg/ml of SMC-394 was sufficient for detection of VGLut1 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Cross Reactivity: No cross-reactivity against VGlut2.
Related Product 1: VGLUT2 pan-specific antibody (Cat. No.: AB-NN323-1)
Related Product 2: VGLUT3 pan-specific antibody (Cat. No.: AB-NN362-1)
Scientific Background: VGLUT1 ((Vesicular glutamate transporter 1) is expressed in a subset of glutamate neurons and transports glutamate into native synaptic vesicles from the brain, exhibiting a conductance for chloride that is blocked by glutamate (1). Vesicular glutamate transport has a substantially lower apparent affinity than the plasma membrane excitatory amino acid transporters. Glutamate transport by VGLUT1 is saturated with a K(m) of approximately 2 mM, in the same range as transport by synaptic vesicles. Finally, plasma membrane glutamate transporters recognize both aspartate and glutamate as substrates, whereas VGLUT1 does not recognize aspartate (2). This description may include information annotated by UniProt and/or Google AI.