Product Name:
Sodium-Iodide Symporter
Product Number:
ab-nn325-1
Target Full Name: Sodium/iodide cotransporter
Target Alias: NIS; SLC5A5; solute carrier family 5; Na (+)I(-) cotransporter
Product Type Specific: NID sodium-Iodide symporter pan-specific antibody
Antibody Code: NN325-1
Antibody Target Type: Pan-specific
Protein UniProt: Q92911
Protein SigNET: Sodium Iodide Symporter
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Mannose binding protein fusion protein with human NIS
Antibody Immunogen Sequence: PSEQTMRVLPSSAARCVALSVNASGLLDPALLPANDSSRAPSSGMDASRPALADSFYAISYLYYGALGTLTTVLCGALISCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL
Antibody Immunogen Description: Corresponds to amino acid residues P468-L643.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: Detects a ~97 kDa protein, non-glycosylated version at 68 kDa protein in cell and tissue lysates by Western blotting. Other minor bands associated with hNIS at 160 kDa protein, and degradation products at ~30 kDa protein, and ~15 kDa protein in cell and tissue lysates by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rat | Mouse.
Antibody Positive Control: 1 µg/ml of SMC-390 was sufficient for detection of hNIS in 20 µg of transfected COS-7 cell membrane lysate by ECL immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Related Product 1: Sodium-Iodide Symporter pan-specific antibody (Cat. No.: AB-NN325-2)
Scientific Background: The sodium iodide symporter (NIS), encoded by the SLC5A5 gene, is an integral membrane glycoprotein (approx. 87 kDa) that actively transports iodide from the bloodstream across the basolateral membrane into thyroid epithelial follicular cells (1, 2). This is important step in the process of iodide organificaton and the formation of triiodothyronine and thyroxine, making NIS crucial for regulating body metabolism and growth (3). It is a transmembrane protein containing 13 transmembrane domains, an extracellular N-terminus, and an intracellular C-terminus. It typically forms dimers stabilized by disulfide bridges. NIS acts as a symporter, utilizing the sodium gradient (maintained by the Na+/K+ATPase pump) to move two sodium cations Na+ alongside one iodide anion (I-)into the cell. While found primarily on the basolateral membrane of thyroid cells, NIS is also expressed during lactation in breast tissue, as well as in the salivary glands, ovaries, and gastric mucosa. This description may include information annotated by UniProt and/or Google AI.