Product Name:

SNAT1


Product Number:

ab-nn324-1

Price:

Regular price
$105.00
Regular price
Sale price
$105.00

Download Product PDF

Target Full Name: Sodium-coupled neutral amino acid transporter 1

Target Alias: SLC38A1; amino acids transporter A1; ATA1; NAT2; Amino acid transporter system A1; N-system amino acid transporter 2; S38A1; SAT1; SNAT 1; Solute carrier family 38 member 1; System A amino acid transporter 1; System N amino acid transporter 1

Product Type Specific: SNAT solute carrier protein pan-specific antibody

Antibody Code: NN324-1

Antibody Target Type: Pan-specific

Protein UniProt: Q9H2H9

Protein SigNET: SNAT1

Antibody Type: Monoclonal

Antibody Host Species: Mouse

Antibody Ig Isotype Clone: IgG1

Antibody Immunogen Source: Fusion protein with N-terminus of rat SNAT1 (Uniprot ID Q9JM15)

Antibody Immunogen Sequence: MMHFKSGLELTELQNMTVPEDDNVSNDSNDFTEVENGQINSKFISDRESRRSLTNSHLEKRKC

Antibody Immunogen Description: Corresponds to amino acid residues M1-C63.

Production Method: Protein G purified

Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.

Antibody Concentration: 1 mg/ml

Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide

Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.

Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence

Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.

Antibody Potency: Detects a ~50 kDa protein in cell and tissue lysates by Western blotting.

Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rat | Mouse.

Antibody Positive Control: 1 µg/ml of SMC-401 was sufficient for detection of SNAT1 in 20 µg of lysates from neocortical neurons cultured under amino acid starvation conditions and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.

Scientific Background: The sodium-coupled neutral amino acid transporters (SNAT) of the SLC38 gene family include System A subtypes SNAT1, SNAT2 and SNAT4 and System N subtypes SNAT3 and SNAT5. The SLC38 transporters are essential for the uptake of nutrients, energy production, metabolism, detoxification, and the cycling of neurotransmitters. The SNAT1 protein, also designated ATA1 or NAT2 is encoded by the human gene SLC38A1 which maps to chromosome 12q13.11. SNAT1 is responsible for the transport of glutamine, an intermediate in the synthesis of urea, and may be involved in the generation of glutamate in the retina. SNAT1 protein may be detected in some tissues such as heart, brain and placenta and expression levels are enriched in certain neuronal populations within the CNS. SNAT1 is not present in astrocytes. This description may include information annotated by UniProt and/or Google AI.