Product Name:
VGLUT2
Product Number:
ab-nn323-1
Target Full Name: Vesicular glutamate transporter 2
Target Alias: Differentiation associated BNPI; DNPI; SLC17A6; Solute carrier family 17 member 6; Differentiation associated Na dependent inorganic phosphate cotransporter; Solute carrier family 17 (Sodium dependent inorganic phosphate cotransporter) member 6; Differentiation associated Na(+) dependent inorganic phosphate cotransporter; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Sodium dependent inorganic phosphate cotransporter
Product Type Specific: VGLUT2 solute carrier protein pan-specific antibody
Antibody Code: NN323-1
Antibody Target Type: Pan-specific
Protein UniProt: Q9P2U8
Protein SigNET: VGLUT2
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with cytoplasmic C-terminus of rat VGlut2 (Uniprot ID Q9JI12)
Antibody Immunogen Sequence: EKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATSQENGGWPNGWEKKEEFVQESAQDAYSYKDRDDYS
Antibody Immunogen Description: Corresponds to amino acid residues E501-S582.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: Detects a ~60 kDa protein in cell and tissue lysates by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Rat | Mouse.
Antibody Positive Control: 1 µg/ml of SMC-395 was sufficient for detection of VGLut2 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
Related Product 1: VGLUT1 pan-specific antibody (Cat. No.: AB-NN361-1)
Related Product 2: VGLUT3 pan-specific antibody (Cat. No.: AB-NN362-1)
Scientific Background: VGLUT2 (Vesicular glutamate transporter 2) is an ATP-dependent, chloride-sensitive vesicular glutamate transporter include BNPI (VGLUT1), VGLUT2 (DNPI) and VGLUT3. The brain expresses BNPI (brain specific Na+-dependent inorganic phosphate (Pi) cotransporter) and VGLUT2 in a complementary fashion. The telencephalic regions express BNPI, whereas the lower brainstem and diencephalic regions express VLGUT2. Rat pinealocytes express both BNPI and VGLUT2. The striatum, hippocampus, cerebral cortex and raphe nuclei express VGLUT3 in a small number of neurons. Pancreatic α and β cells express BNPI and VGLUT2 in response to glucose concentrations. Human VGLUT3 shares a 72% sequence homology with VLGUT2 and BNPI. This description may include information annotated by UniProt and/or Google AI.