Product Name:
KCC2
Product Number:
ab-nn322-1
Target Full Name: Solute carrier family 12 member 5
Target Alias: Potassium Chloride Cotransporter; Potassium chloride transporter 5; SLC12A5; hKCC2; S12A5; Solute carrier family 12 member 5; Electroneutral potassium-chloride cotransporter 2; Furosemide-sensitive K-Cl cotransporter; K-Cl cotransporter 2; rKCC2; Neuronal K-Cl cotransporter; KIAA1176; Electroneutral potassium chloride cotransporter 2; Erythroid K Cl cotransporter 2; Furosemide sensitive K Cl cotransporter; K-Cl cotransporter 2; KCC 2; Neuronal K Cl cotransporter; Solute carrier family 12 (potassium chloride transporter) member 5
Product Type Specific: Potassium Chloride cotransport protein pan-specific antibody
Antibody Code: NN322-1
Antibody Target Type: Pan-specific
Protein UniProt: Q9H2X9
Protein SigNET: KCC2
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG2a
Antibody Immunogen Source: Fusion protein with long peptide from rat KCC2 (Uniprot ID Q63633)
Antibody Immunogen Sequence: MEQRSQILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETACDNEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSAAQKNKG
Antibody Immunogen Description: Corresponds to amino acid residues M932-G1043.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | Immunoprecipitation
Antibody Dilution Recommended: WB (1:1000), IHC (1:300); optimal dilutions for assays should be determined by the user.
Antibody Potency: Detects a ~140 kDa protein in cell and tissue lysates by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rhesus macaque | Rat | Mouse.
Antibody Positive Control: 1 µg/ml of SMC-392 was sufficient for detection of KCC2 in 10 µg of rat brain lysate by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
Scientific Background: KCC2 (Solute carrier family 12 member 5; SLC12A5) is an electroneutral potassium-chloride cotransport protein that belongs to the SLC12A transporter family.It is a neuron-specific, ~130-145 kDa transmembrane protein essential for maintaining low intracellular chloride levels in the central nervous system. It acts as a cotransporter, enabling fast hyperpolarizing inhibition by GABA and glycine. It is crucial for mature neuronal excitability, dendritic spine formation. As major extruder of intracellular chloride, it establishes the low neuronal Cl(-) levels required for chloride influx after binding of GABA-A and glycine to their receptors, with subsequent hyperpolarization and neuronal inhibition. It consists of 12 membrane-spanning segments with intracellular N- and C-terminal domains. It is localized specifically in the cell bodies of neurones, and plasma membrane of neuronal soma and dendrites, particularly at the postsynaptic density, where it regulates dendritic spine formation, synaptic strength and dendritic signal integration. Beyond ion transport, KCC2 interacts with the actin cytoskeleton through its C-terminal domain (CTD) and protein 4.1N, playing a crucial role in dendritic spine morphogenesis and maturation. KCC2 activity is heavily regulated by phosphorylation. Key sites include Ser-940 (phosphorylated by PKC), which enhances surface expression, and Thr-906/Thr-1007 (phosphorylated by WNK kinases), which inhibits transporter activity. inhibitory mutations or reduced expression in KCC2 are linked with various neurological conditions, including epilepsy, traumatic brain injury, schizophrenia, and autism. This description may include information annotated by UniProt and/or Google AI.

