Product Name:
SHANK1/SHANK3
Product Number:
ab-nn319-1
Target Full Name: SH3 and multiple ankyrin repeat domains protein 3
Target Alias: Shank postsynaptic density protein; SH3 and multiple ankyrin repeat domains 3; Proline rich synapse associated protein 2; Proline-rich synapse-associated protein 2; ProSAP2; PSAP2; ; SH3 and multiple ankyrin repeat domains protein 3; SH3/ankyrin domain gene 3;Shank3b; SPANK 2; SPANK2; KAP/SAPAP interacting protein; OTTHUMP00000174437; SH3 and multiple ankyrin repeat domains 1; SH3 and multiple ankyrin repeat domains protein 1; SH3/ankyrin domain gene 1; SHANK 1; Shank1; Shank1a; Somatostatin receptor interacting protein; Somatostatin receptor-interacting protein ; SPANK 1; SPANK1; SSTR interacting protein; SSTR-interacting protein; SSTRIP; Synamon; AI841104; DEL22q13.3; KIAA1650
Product Type Specific: SHANK3 synaptic protein pan-specific antibody
Antibody Code: NN319-1
Antibody Target Type: Pan-specific
Protein UniProt: Q9BYB0
Protein SigNET: SHANK1/SHANK3
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG2a
Antibody Immunogen Source: Fusion protein with SH3 domain of rat SHANK3 (Uniprot ID Q9JLU4)
Antibody Immunogen Sequence: TREDRTKRLFRHYTVGSYDSLTSHSDYVIDDKVAILQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWKAGLRTG
Antibody Immunogen Description: Corresponds to amino acid residues T538-G626. Mouse: 100% identity (89/89 amino acids identical). Human: 97% identity (87/89 amino acids identical). ~70% identity with SHANK1 and SHANK2.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH 7.4, 50% glycerol, 0.1% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: In mouse brain lysates, this antibody detects a ~190 kDa protein in cell and tissue lysates by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Rat | Mouse.
Antibody Positive Control: 1 µg/ml of SMC-460 was sufficient for detection of SHANK1/SHANK3 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Antibody Cross Reactivity: Cross-reacts with SHANK1. Does not cross-react with SHANK2.
Related Product 1: SHANK2 pan-specific antibody (Cat. No.: AB-NN318-1)
Scientific Background: SHANK proteins are scaffolding adaptors that have been shown to integrate neurotransmitter receptors into the cortical cytoskeleton at postsynaptic densities. SHANK1-3 of the SHANK/ProSAP family are molecular scaffolds in the postsynaptic density (PSD). SHANK recruits betaPIX and PAK to dendritic spines to regulate postsynaptic structure and interacts with ionotropic receptor and metabotropic glutamate receptor complexes. Transcript splice variation in the Shank family influences the spectrum of Shank-interacting proteins in the PSDs of adult and developing brain to ensure normal development. This description may include information annotated by UniProt and/or Google AI.

