Product Name:
REEP2
Product Number:
ab-nn312-2
Target Full Name: Receptor expression-enhancing protein 2
Target Alias: C2orf19; SGC32445; LOC682105
Product Type Specific: REEP2 pan-specific antibody
Antibody Code: NN312-2
Antibody Target Type: Pan-specific
Protein UniProt: Q9BRK0
Protein SigNET: REEP2
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG2A
Antibody Immunogen Source: Fusion protein with cytoplasmic C-terminus of mouse REEP2 (Uniprot ID Q8VCD6)
Antibody Immunogen Sequence: RDKSYETMMRVGKRGLNLAANAAVTAAAKGQGVLSEKLRSFSMQDLTLIRDEDALPLQGPDGRLQPGPVGLLDTIEDLGDEPALSLRSSTSQPDPRTETSEDDLGDKAPKRTKPIKKVPRAEPPASKTLKTRPKKKSSGGGDSA
Antibody Immunogen Description: Corresponds to amino acid residues R111-A254.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.1% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: In mouse brain lysates, this antibody detects a ~30 kDa protein by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Rat | Mouse.
Antibody Positive Control: A 1:100 dilution of SMC-481 was sufficient for detection of REEP2 in 20 µg of mouse brain lysate by ECL immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Antibody Cross Reactivity: One weak ~75 kDa cross-reactive protein in mouse brain lysates.
Related Product 1: REEP1 pan-specific antibody (Cat. No.: AB-NN312-1)
Scientific Background: REEP2 (Receptor Expression Enhancing Protein 2) is an integral membrane protein that shapes the endoplasmic reticulum (ER) and aids in receptor trafficking/function, particularly in neurons and taste cells. It plays a critical role in maintaining ER structure, with mutations causing hereditary spastic paraplegia (HSP), a neurodegenerative disorder. It belongs to the REEP family, which are transmembrane proteins that interact with odorant receptor proteins and may enhance the odorant receptor responses to odorants. REEP2 is also an integral membrane protein expressed in taste cells. Unlike its counterpart REEP1, REEP2 does not increase cell surface expression to sweet receptors, but instead alters their spatial organization (1). It belongs to the DP1/Yop1p family and works by forming hairpin structures that insert into the ER membrane, often working alongside or similarly to REEP1. It features two highly conserved hydrophobic domains at the N-terminus, allowing it to interact with membranes and promote protein oligomerization. Mutations in the REEP2 gene are linked to hereditary spastic paraplegias (SPG72), causing progressive lower limb spasticity. This description may include information annotated by UniProt and/or Google AI.