Product Name:
REEP1
Product Number:
ab-nn312-1
Target Full Name: Receptor expression-enhancing protein 1
Target Alias: C2orf23; D6Ertd253e; rcG_56072; Reep1; SPG31; FLJ13110
Product Type Specific: REEP1 pan-specific antibody
Antibody Code: NN312-1
Antibody Target Type: Pan-specific
Protein UniProt: Q9H902
Protein SigNET: REEP1
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG2B
Antibody Immunogen Source: Fusion protein with mouse REEP1 (Uniprot ID Q8BGH4)
Antibody Immunogen Sequence: KEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGTGRSSGKHSQPKMSRSASESAGSSGTA
Antibody Immunogen Description: Corresponds to amino acid residues K111-A201.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.1% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: In mouse brain lysates, this antibody detects a ~22 kDa protein by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Rat | Mouse.
Antibody Positive Control: A 1:100 dilution of SMC-480 was sufficient for detection of REEP1 in 20 µg of mouse brain lysate by ECL immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Related Product 1: REEP2 pan-specific antibody (Cat. No.: AB-NN312-2)
Scientific Background: REEP1 (receptor expression-enhancing protein 1), is a 201 amino acid multi-pass mitochondrion membrane protein that belongs to the DP1 family. REEP1 interacts with odorant receptor proteins and may enhance the cell surface expression of odorant receptors (1, 2). It is also required for endoplasmic-reticulum network formation shaping and remodeling by linking ER tubules to the cytoskeleton (2). Mutations in the REEP1 gene are a common cause of hereditary spastic paraplegia (HSP). Mutations in the REEP1 gene also cause spastic paraplegia autosomal dominant type 31, a neurodegenerative disorder (3). This description may include information annotated by UniProt and/or Google AI.

