Product Name:
Protocadherin Gamma A1 (pan)
Product Number:
ab-nn308-1
Target Full Name: Protocadherin gamma A1
Target Alias: PCDH gamma A; PCDH-gamma-A; PCDHGA; Protocadherin gamma A; Protocadherin gamma subfamily A; Gamma Protocadherin A (pan); Pan-Gamma-Protocadherin-A; Pan Gamma Protocadherin A
Product Type Specific: Protocadherin gamma A1 intercellular junction protein pan-specific antibody
Antibody Code: NN308-1
Antibody Target Type: Pan-specific
Protein UniProt: Q9Y5H4
Protein SigNET: Protocadherin Gamma A1
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with C-terminal cytoplasmic constant domain of mouse Protocadherin-gamma-A1 (Uniprot ID Q91XZ0) that is shared by all 22 Gamma-protocadherins in a subfamily with amino acids ~807-930, B subfamily amino acids ~789-912 and C subfamily amino acids ~818-941)
Antibody Immunogen Sequence: QAPPNTDWRFSQAQRPGTSGSQNGDETGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEKK
Antibody Immunogen Description: Corresponds to amino acid residues Q808-K931. 99% identity with human (123/124 amino acids).
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH 7.4, 50% glycerol, 0.1% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: Detects a ~100 kDa protein in cell and tissue lysates by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Chimpanzee | Rat | Mouse.
Antibody Positive Control: 1 µg/ml of SMC-454 was sufficient for detection of Protocadherin gamma (pan) in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Cross Reactivity: Cross-reacts with all Gamma-protocadherin-A, -B and -C proteins.
Related Product 1: Protocadherin Gamma A (pan) pan-specific antibody (Cat. No.: AB-NN308-2)
Related Product 2: Protocadherin Gamma A3 pan-specific antibody (Cat. No.: AB-NN302-1)
Related Product 3: Protocadherin Gamma B2 pan-specific antibody (Cat. No.: AB-NN303-1)
Related Product 4: Protocadherin Gamma C3 pan-specific antibody (Cat. No.: AB-NN304-1)
Scientific Background: The protocadherin gamma gene cluster is one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes. This description may include information annotated by UniProt and/or Google AI.

