Product Name:
Neuroligin 4
Product Number:
ab-nn296-1
Target Full Name: Neuroligin 4-like
Target Alias: ASPGX2; AUTSX2; HLNX; HNLX; KIAA1260; MGC22376; NLGN; NLGN4; NLGN4X; neuroligin-4 X-linked; neuroligin X; neuroligin 4; X-linked
Product Type Specific: Synaptic protein pan-specific antibody
Antibody Code: NN296-1
Antibody Target Type: Pan-specific
Protein UniProt: Q8N0W4
Protein SigNET: Neuroligin 4
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with intracellular C-terminus of mouse Neuroligin 4 (Uniprot ID B0F2B4)
Antibody Immunogen Sequence: YYKKDKRRHETHRRPPPPRPPQAPPSAAAADRNPRPDPGPAGRRGGECGAVVTAMAAEASAGGLGHDGVGGVGVGGVIGGVAGLRLACPPDYALTLRRSPDDVPRAGAGPGTMTLIPGALGGGGGGAVHGFNTFGSGVGVAGVAGVATSQAGPGLPHGHSTTRV
Antibody Immunogen Description: Corresponds to amino acid residues Y782-V945. ~45% identity with Neuroligin-1, -2 and -3.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH 7.4, 50% glycerol, 0.1% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: In mouse brain lysates, this antibody detects a ~25-130 kDa protein by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Mouse.
Antibody Positive Control: 1 µg/ml of SMC-469 was sufficient for detection of Neuroligin 4 in 20 µg of mouse brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Related Product 1: Neuroligin 3 pan-specific antibody (Cat. No.: AB-NN295-1)
Related Product 2: Neuroligin 1 pan-specific antibody (Cat. No.: AB-NN294-1)
Scientific Background: This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs, large (Drosophila) homolog 4 (DLG4). Mutations in this gene have been associated with autism and Asperger syndrome. Two transcript variants encoding the same protein have been identified for this gene. This description may include information annotated by UniProt and/or Google AI.