Product Name:
Neuroligin 3
Product Number:
ab-nn295-1
Target Full Name: Neuroligin-3
Target Alias: Gliotactin homologue; Nlgn3; NLGN3_HUMAN
Product Type Specific: Synaptic protein pan-specific antibody
Antibody Code: NN295-1
Antibody Target Type: Pan-specific
Protein UniProt: Q9NZ94
Protein SigNET: Neuroligin 3
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with intracellular C-terminus of rat Neuroligin-3 (Uniprot ID Q62889)
Antibody Immunogen Sequence: YYRKDKRRQEPLRQPSPQRGTGAPELGTAPEEELAALQLGPTHHECEAGPPHDTLRLTALPDYTLTLRRSPDDIPLMTPNTITMIPNSLVGLQTLHPYNTFAAGFNSTGLPNSHSTTRV
Antibody Immunogen Description: Corresponds to amino acid residues Y730-V848. Mouse: 99% identity (118/119 amino acids identical); Human: 98% identity (116/119 amino acids identical); ~60% identity with Neuroligin-1; ~40% identity with Neuroligin-2.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH 7.4, 50% glycerol, 0.1% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: In mouse brain lysates, this antibody detects a ~110 kDa protein by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Chimpanzee | Dog | Rat | Mouse | Platypus | Chicken.
Antibody Positive Control: 1 µg/ml of SMC-471 was sufficient for detection of Neuroligin 3 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: High
Antibody Cross Reactivity: Does not cross-react with Neuroligin-1, -2, -4 or -4. Weak~120 kDa target protein and one very strong ~75 kDa cross-reactive protein in mouse brain lysates.
Related Product 1: Neuroligin 1 pan-specific antibody (Cat. No.: AB-NN294-1)
Related Product 2: Neuroligin 4 pan-specific antibody (Cat. No.: AB-NN296-1)
Scientific Background: Neuroligins are Type I membrane proteins enriched in synaptic plasma membranes and clustered in synaptic clefts and postsynaptic densities. They play a major role in the formation or maintenance of synaptic junctions. They are also thought to be involved in the specification of excitatory synapses. Neuroligin-3 (NLGN3) is a postsynaptic, single-pass transmembrane cell adhesion molecule that is important for synaptic development, organization, and stabilization. It bridges synapses by binding with presynaptic beta-neurexins. It features a large extracellular cholinesterase-like domain (ECD), a transmembrane helix, and a short intracellular domain. NLGN3 can be cleaved on its juxtamembrane domain in response to neuronal activity. It acts as a homodimer or heterodimer (with NLGN1/2). It is found in neurons and, specifically, on astrocytes in the brain, and located at the postsynaptic density of both excitatory (glutamatergic) and inhibitory (GABAergic) synapses. Mutations like R451C are associated with autism spectrum disorder (ASD) and Asperger syndrome due to its role in maintaining excitatory/inhibitory balance. In addition to its role in synaptogenesis, studies show its absence or mutation can lead to impaired social behavior and altered synapse function. This description may include information annotated by UniProt and/or Google AI.

