Product Name:
Neuroligin 1
Product Number:
ab-nn294-1
Target Full Name: Neuroligin-1
Target Alias: NLG 1; KIAA1070; MGC45115; NL1; NLG1; Nlgn1
Product Type Specific: Synaptic protein pan-specific antibody
Antibody Code: NN294-1
Antibody Target Type: Pan-specific
Protein UniProt: Q8N2Q7
Protein SigNET: Neuroligin 1
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with cytoplasmic C-terminus) of rat Neuroligin-1 (Uniprot ID Q62765)
Antibody Immunogen Sequence: YYKKDKRRHDVHRRCSPQRTTTNDLTHAPEEEIMSLQMKHTDLDHECESIHPHEVVLRTACPPDYTLAMRRSPDDVPLMTPNTITMIPNTIPGIQPLHTFNTFTGGQNNTLPHPHPHPHSHSTTRV
Antibody Immunogen Description: Corresponds to amino acid residues Y718-V843. Mouse: 99% identity (125/126 amino acids identical): Human: 99% identity (125/126 amino acids identical) >40% identity with Neuroligin-2 and -3.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH 7.4, 50% glycerol, 0.1% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: In mouse brain lysates, this antibody detects a ~120 kDa protein by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Chimpanzee | Rhesus macaque | Dog | Rat | Mouse | Chicken.
Antibody Positive Control: 2 µg/ml of SMC-463 was sufficient for detection of Neuroligin-1 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Antibody Cross Reactivity: Does not cross-react with other Neuroligins.
Related Product 1: Neuroligin 3 pan-specific antibody (Cat. No.: AB-NN295-1)
Related Product 2: Neuroligin 4 pan-specific antibody (Cat. No.: AB-NN296-1)
Scientific Background: Neuroligin-1 (NLGN1) is a 116 kDa neuronal cell surface protein belonging to the type-B carboxylesterase/lipase family. It is a postsynaptic cell adhesion protein that is important for excitatory synapse formation, maturation, and stabilization. Located on neurons, it binds to specific presynaptic beta-neurexins, to initiates synapse maturation. It regulates NMDA and AMPA receptor clustering in synapses, synaptic transmission, symapse remodeling, and long-term potentiation (LTP). NLGN1 is a necessary component in the maturation of excitatory synapses for their normal, functional development, and is necessary to the regulation of synaptic plasticity and the development of long-term memory within the adult amygdala in mammals. It is believed to participate in cell-cell-interaction through the assembly of intracellular junction by the binding of beta-neurexins, and may also be a factor in the maintenance and assembly of synaptic junctions. NLGN1 is also thought to have involvement in excitatory synaptic specification. It features an extracellular esterase domain (catalytically inactive), a transmembrane domain, and a cytoplasmic tail that binds to scaffolding proteins like PSD-95. Within brain tissue, NLGN1 is primarily observed in neurons and spinal cord. Mutations in the NLGN1 gene are linked to Autism Spectrum Disorders (ASDs) and schizophrenia. Decreased levels (50–60% reduction) of NLGN1 are found in the brains of Alzheimer's disease (AD) patients, making it a target of synaptic dysfunction caused by amyloid-beta oligomers. It has been implicated in promoting metastasis in certain cancers, such as colorectal cancer. This description may include information annotated by UniProt and/or Google AI.