Product Name:
NALCN
Product Number:
ab-nn293-1
Target Full Name: Sodium leak channel non-selective protein
Target Alias: VGCNL1; CanIon; Voltage gated channel-like protein 1; A530023G15Rik; bA430M15.1; FLJ23913; FLJ44659; FLJ44764; Four repeat voltage gated ion channel; MGC74524; Putative 4 repeat voltage gated ion channel; Sodium leak channel non-selective protein
Product Type Specific: Sodium channel pan-specific antibody
Antibody Code: NN293-1
Antibody Target Type: Pan-specific
Protein UniProt: Q8IZF0
Protein SigNET: NALCN
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with cytoplasmic C-terminus of rat NALCN (Uniprot ID Q6Q760)
Antibody Immunogen Sequence: DTGKPQRKIGQWRLPSAPKPISHSVSSVNLRFGGRTTMKSVVCKMNPMPDTASCGSEVKKWWTRQLTVESDESGDDLLDI
Antibody Immunogen Description: Corresponds to amino acid residues D1659-I1738.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: In mouse brain lysates, this antibody detects a ~200 kDa protein by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rhesus macaque | Dog | Rat | Mouse | Platypus | Chicken.
Antibody Positive Control: 1 µg/ml of SMC-417 was sufficient for detection of NALCN in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP asthe secondary antibody. immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Scientific Background: NALCN (sodium leak channel non-selective protein), also known as CanIon or VGCNL1 (voltage gated channel-like protein 1), is a 1,738 amino acid multi-pass membrane protein that belongs to the cation-nonselective channel family. NALCN is highly conserved in mammals and is widely expressed in the central nervous system. Three isoforms of NALCN exists due to alternative splicing events. It features four homologous domains, each with six transmembrane (TM) segments, and it is structurally similar to voltage-gated sodium (Nav) and calcium (Cav) channels. It is activated by NK-1R. NALCN is a voltage-independent, nonselective cation channel that is permeable to sodium, potassium and calcium ions. NALCN is responsible for background sodium ion leak conductance in neurons and regulates basal excitability of the nervous systems. Unlike traditional voltage-gated channels, NALCN remains constitutively open ("leaky") at normal resting membrane potentials, allowing small amounts of Na+ to enter neurons, which keeps them near the threshold for firing action potentials. NALCN forms a channel complex with FAM155A, UNC80, and UNC79, with UNC-79 and UNC-80 act as scaffolding proteins that enhance the stability and surface expression of NALCN. The complex is regulated by various G-protein coupled receptors (GPCRs), such as GABA-B and muscarinic receptors (e.g., M3R), which can activate or inhibit the channel, often via Src family tyrosine kinases (SFKs) rather than traditional G-protein signalling. It is widely expressed in the central nervous system, with moderate levels in the heart and pancreas. Defects of NALCN in mice causes disruption in respiratory rhythm and death occurs within 24 hours of birth. Mutations in the NALCN gene are associated with severe human diseases, including infantile neuroaxonal dystrophy, infantile hypotonia with psychomotor retardation and characteristic facies (IHPRF), and congenital contractures of the limbs and face with hypotonia and developmental delay (CLIFAHDD). This description may include information annotated by UniProt and/or Google AI.