Product Name:
Kv3.2
Product Number:
ab-nn283-1
Target Full Name: Potassium voltage-gated channel subfamily C member 2
Target Alias: Kcnc2; KSHIIIA
Product Type Specific: Kv3.2 potassium channel pan-specific antibody
Antibody Code: NN283-1
Antibody Target Type: Pan-specific
Protein UniProt: Q96PR1
Protein SigNET: Kv3.2
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with cytoplasmic C-terminus of rat Kv3.2a (Uniprot ID P22462)
Antibody Immunogen Sequence: NNFGMYYSLAMAKQKLPRKRKKHIPPAPLASSPTFCKTELNMACNSTQSDTCLGKENRLLEHNRSVLSGDDSTGSEPPLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKGYEKSRSLNNIAGLAGNALR
Antibody Immunogen Description: Corresponds to amino acid residues N474-R613.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.1% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: In mouse brain lysates, this antibody detects a ~80-100 kDa protein in cell and tissue lysates by Western blotting. Varies due to post-translational modifications.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rat | Mouse.
Antibody Positive Control: A 1:100 dilution of SMC-492 was sufficient for detection of Kv3.2 in 20 µg of mouse brain lysate by ECL immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Related Product 1: Kv3.1 pan-specific antibody (Cat. No.: AB-NN282-1)
Related Product 2: Kv4.2 S963 phosphorylation antibody (Cat. No.: AB-PN832)
Related Product 3: Kv4.2 T602+T607 phosphorylation antibody (Cat. No.: AB-PN833)
Scientific Background: Kv3.2, a member of the KCNC2 gene family is a voltage-gated potassium channel subunit that belongs to the Shaw-related subfamily (Kv3). It is a member of group of potassium channels that contribute to the maintenance of cell volume, membrane potential, neuronal excitability and the secretion of transmitters, salt and hormones. It is a multipass membrane protein that functions as a tetramer (homotetramer or heterotetramer with other Kv3 subunits, such as Kv3.1). It functions as a delayed rectifier potassium channel, characterized by its ability to activate and deactivate rapidly at high-threshold voltages, allowing for high-frequency action potential generation in neurons. Kv3.2 are predominantly expressed in neurons that fire at high frequencies, and in the fast spiking GABAergic interneurons of the neocortex, hippocampus, and caudate nucleus (1-3). They specifically functioning as a delayed rectifier activated by large membrane depolarizations (2, 4). It is primarily expressed in the central nervous system (CNS), with high levels in the cortex, hippocampus, basal ganglia (caudate nucleus), and reticular nucleus of the thalamus.Kv3.2 localizes to the somata, proximal dendrites, and axonal terminals of GABAergic interneurons. Mutations in the KCNC2 gene are associated with developmental and epileptic encephalopathy-103 (DEE103). Pathogenic variants often cause a gain-of-function effect (e.g., higher current density, shift in activation to more hyperpolarized potentials), which paradoxically impairs fast-spiking interneurons and leads to network-level disinhibition, causing epilepsy.A reduction in KCNC2 is associated with increased ER stress and increased risk of obesity-mediated diabetes. This description may include information annotated by UniProt and/or Google AI.