Product Name:

Kv3.1


Product Number:

ab-nn282-1

Price:

Regular price
$105.00
Regular price
Sale price
$105.00

Download Product PDF

Target Full Name: Potassium voltage-gated channel subfamily C member 1

Target Alias: Krc2 1; NGK2; KCNC1; voltage gated potassium channel subunit Kv3.1; Kv4

Product Type Specific: Potassium channel pan-specific antibody

Antibody Code: NN282-1

Antibody Target Type: Pan-specific

Protein UniProt: P48547

Protein SigNET: Kv3.1

Antibody Type: Monoclonal

Antibody Host Species: Mouse

Antibody Ig Isotype Clone: IgG1

Antibody Immunogen Source: Fusion protein with C-terminus of rat Kv3.1b (Uniprot ID P25122)

Antibody Immunogen Sequence: NNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPHHSTQSDTCPLAQEEILEINRADSKLNGEVAKAALANEDCPHIDQALTPDEGLPFTRSGTRERYGPCFLLSTGEYACPPGGGMRKDLCKESPVIAKYMPTEAVRVT

Antibody Immunogen Description: Corresponds to amino acid residues N437-T585.

Production Method: Protein G purified

Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.

Antibody Concentration: 1 mg/ml

Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide

Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.

Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence

Antibody Dilution Recommended: WB (1:1000), IHC (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.

Antibody Potency: Detects a ~110 kDa protein in cell and tissue lysates by Western blotting. Weakly reactive in human samples.

Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Chimpanzee | Rhesus macaque | Rat | Mouse.

Antibody Positive Control: 1 µg/ml of SMC-313 was sufficient for detection of Kv3.1b in 10 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.

Antibody Specificity: Very high

Scientific Background: Potassium voltage-gated channel, Shaw-related subfamily, member 1, also known as KCNC1 or Kv3.1, is a human gene. The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily (1). The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. Kv3.1b has been extensively tested in the auditory regions of mammals, and the decline of Kv3.1b expression appears to correlate with the functional decline in the medial olivocochlear efferent system (2). Other research shows potential for Kv3.1b channels to be oxygen sensors (3). This description may include information annotated by UniProt and/or Google AI.