Product Name:
Kir6.1
Product Number:
ab-nn280-1
Target Full Name: ATP-sensitive inward rectifier potassium channel 8
Target Alias: Potassium channel inwardly rectifying subfamily J member 8; uKATP-1; Kcnj8
Product Type Specific: Potassium channel pan-specific antibody
Antibody Code: NN280-1
Antibody Target Type: Pan-specific
Protein UniProt: Q15842
Protein SigNET: Kir6.1
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG2A
Antibody Immunogen Source: Fusion protein with the cytoplasmic C-terminus of rat Kir6.1 (Uniprot ID Q63664)
Antibody Immunogen Sequence: TQARTSYIAEEIQWGHRFVSIVTEEEGVYSVDYSKFGNTVRVAAPRCSARELDEKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRSNSIRRNNSSLMVPKVQFMTPEGNQCPSES
Antibody Immunogen Description: Corresponds to amino acid residues T306-S424 .
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.1% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: In mouse brain lysates, this antibody detects a ~45 kDa protein by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rhesus macaque | Rat | Mouse | Zebra fish.
Antibody Positive Control: A 1:100 dilution of SMC-491 was sufficient for detection of Kir6.1 in 20 µg of mouse brain lysate by ECL immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Scientific Background: SCYL1 (SCY1-like pseudokinase 1) is a protein-serine/threonine kinase of the Other group and SCY1 family. It is a multifunctional protein that acts as a transcriptional regulator and a key component in intracellular transport, particularly in COPI-mediated retrograde transport between the Golgi apparatus and endoplasmic reticulum. As a catalytically inactive pseudokinase, it regulates Golgi morphology, tRNA nuclear/cytoplasmic trafficking, and gene expression. Although it is apparently devoid of any measurable phosphotransferase activity in vitro, its isoform (6) can bind 3 GC-rich sequences (box -A, -B, or -C) in the beta-polymerase promoter region. SCYL1 features an N-terminal kinase-like domain (catalytically inactive), central HEAT repeats, and a C-terminal coiled-coil domain. It functions as a scaffold or regulator in COPI-mediated transport by binding directly to COPI coats, crucial for Golgi homeostasis. It acts as a transcriptional activator for telomerase reverse transcriptase (TERT) and DNA polymerase beta genes, often binding to GC-rich DNA sequences (e.g., via the TEIF domain). It is ocated in the cytoplasm, Golgi apparatus, and nucleus. Mutations in SCYL1 are linked to SCAR21 (spinocerebellar ataxia), a disorder featuring cerebellum degeneration, ataxia, and liver O1394dysfunction. Overexpression is associated with cancer progression and poor prognosis in breast cancer. This description may include information annotated by UniProt and/or Google AI.