Product Name:
Kir2.3
Product Number:
ab-nn279-1
Target Full Name: Inward rectifier potassium channel 4
Target Alias: IRK3; HIR; HIRK2; HRK1; KCNJ4; potassium inwardly rectifying channel subfamily J member 4
Product Type Specific: Potassium channel pan-specific antibody
Antibody Code: NN279-1
Antibody Target Type: Pan-specific
Protein UniProt: P48050
Protein SigNET: Kir2.3
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein amino acids of human Kir2.3
Antibody Immunogen Sequence: EAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI
Antibody Immunogen Description: Corresponds to amino acid residues E390-I445 .
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000), IHC (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.
Antibody Potency: Medium-high potency. Detects a ~45 kDa protein in cell and tissue lysates by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rat | Mouse.
Antibody Positive Control: 1 µg/ml of SMC-312 was sufficient for detection of Kir2.3 in 10 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Antibody Cross Reactivity: No cross-reactivity against Kir2.1 or Kir2.2.
Related Product 1: Kir2.2 pan-specific antibody (Cat. No.: AB-NN278-1)
Scientific Background: Several different potassium channels are known to be involved with electrical signalling in the nervous system. One class is activated by depolarization whereas a second class is not. The latter are referred to as inwardly rectifying K+ channels, and they have a greater tendency to allow potassium to flow into the cell rather than out of it. This asymmetry in potassium ion conductance plays a key role in the excitability of muscle cells and neurons. The protein encoded by this gene is an integral membrane protein and member of the inward rectifier potassium channel family. The encoded protein has a small unitary conductance compared to other members of this protein family. Two transcript variants encoding the same protein have been found for this gene (1-3). This description may include information annotated by UniProt and/or Google AI.

