Product Name:
Kir2.2
Product Number:
ab-nn278-1
Target Full Name: ATP-sensitive inward rectifier potassium channel 12
Target Alias: IRK2; KCNJ12; kcnj12x; KCNJN1; Kir2.2v; potassium inwardly rectifying channel subfamily J member 12
Product Type Specific: Potassium channel pan-specific antibody
Antibody Code: NN278-1
Antibody Target Type: Pan-specific
Protein UniProt: Q14500
Protein SigNET: Kir2.2
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with rat Kir2.2 (Uniprot ID P52188)
Antibody Immunogen Sequence: LVENKFLLPSANSFCYENELAFLSRDEEDEVATDRDGRSPQPEHDFDRLQASSGALERPYRRESEI
Antibody Immunogen Description: Corresponds to amino acid residues L362-I427.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000), IHC (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.
Antibody Potency: Medium potency. Detects a ~45 kDa protein in cell and tissue lysates by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rat | Mouse.
Antibody Positive Control: 1 µg/ml of SMC-311 was sufficient for detection of Kir2.2 in 30 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Antibody Cross Reactivity: No cross-reactivity against Kir2.2 or Kir2.3.
Related Product 1: Kir2.3 pan-specific antibody (Cat. No.: AB-NN279-1)
Scientific Background: The Kir2.1 is a strong inward-rectifier potassium channel protein, encoded by the KCNJ2 gene, and is essential for stabilizing the resting membrane potential and regulating action potential duration in excitable cells, particularly in the heart, skeletal muscle, and brain. It forms a homotetrameric channel consisting of four identical subunits, each with two transmembrane domains (M1, M2), a pore-forming P-loop, and large cytoplasmic N- and C-termini. Channel activity is promoted by phosphatidylinositol 4,5-bisphosphate (PIP2) binding at the C-terminus, while inward rectification is caused by intracellular polyamines and Mg2+ blocking the channel during depolarization. Mutations in KCNJ2 cause Andersen-Tawil syndrome, short QT syndrome, and atrial fibrillation, often resulting in severe cardiac arrhythmias and developmental defects (1). This description may include information annotated by UniProt and/or Google AI.