Product Name:
HCN4
Product Number:
ab-nn266-1
Target Full Name: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
Target Alias: Hyperpolarization activated cyclic nucleotide gated potassium channel 4; HCN 4
Product Type Specific: Potassium channel pan-specific antibody
Antibody Code: NN266-1
Antibody Target Type: Pan-specific
Protein UniProt: Q9Y3Q4
Protein SigNET: HCN4
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with C-terminus of rat HCN4 (Uniprot ID Q9JKA7)
Antibody Immunogen Sequence: RAGGGSGSSGGLGPPGRPYGAIPGQHVTLPRKTSSGSLPPPLSLFGARAASSGGPPLTAAPQREPGARSEPVRSKLPS
Antibody Immunogen Description: Corresponds to amino acid residues R1019-S1198.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000), IHC (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.
Antibody Potency: High potency. Detects a ~130 kDa protein in cell and tissue lysates by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rat | Mouse.
Antibody Positive Control: 1 µg/ml of SMC-320 was sufficient for detection of HCN4 in 10 µg of COS cell lysate transiently transfected with HCN4 by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Antibody Cross Reactivity: No cross-reactivity against other HCNs.
Scientific Background: HCN4 (Hyperpolarization-activated cyclic nucleotide-gated channel 4) is a 129 kDa transmembrane protein that acts as a primary pacemaker channel in the heart's sinoatrial node, regulating heart rate by generating the "funny" current (1). It is a cation channel activated by membrane hyperpolarization and cAMP, facilitating inward Na⁺ and K⁺ flow. Hyperpolarization-activated cation channels of the HCN gene family contribute to spontaneous rhythmic activity in both the heart and brain (1). Among HCN subtypes, it has the slowest activation/deactivation kinetics but highest sensitivity to cAMP. It features four subunits, each containing six transmembrane segments (S1-S6), a voltage-sensing segment (S4), and a cyclic nucleotide-binding domain (CNBD) on the C-terminus that binds cAMP. It is primarily expressed in the sinoatrial node, conduction system, and some brain regions (e.g., thalamus). Mutations in the human HCN4 gene are linked to cardiac conditions including bradycardia, atrial fibrillation, and dilated cardiomyopathy. The channel is a target for medications like ivabradine. This description may include information annotated by UniProt and/or Google AI.