Product Name:
GABA-A Receptor Beta1
Product Number:
ab-nn253-1
Target Full Name: Gamma-aminobutyric acid receptor subunit beta-1
Target Alias: AW061132; B230208N19Rik; GABA(A) receptor beta 1; GABA(A) receptor subunit beta-1; GABA-A receptor beta-1 polypeptide; Gabrb-1; GABRB1; Gamma aminobutyric acid (GABA) A receptor beta 1; Gamma Aminobutyric Acid A Receptor Beta 1; Gamma Aminobutyric Acid Receptor beta-1; Gamma-aminobutyric acid (GABA) A receptor subunit beta 1; Gamma-aminobutyric acid receptor subunit beta-1; GARB1; GBRB1_HUMAN antibody
Product Type Specific: GABRB1 chloride channel pan-specific antibody
Antibody Code: NN253-1
Antibody Target Type: Pan-specific
Protein UniProt: P18505
Protein SigNET: GABA-A Receptor Beta1
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with mouse GABA-A-R-Beta1 peptide
Antibody Immunogen Sequence: VNYIFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTSVSDPKATMYSYDSASIQYRKPLSSREAYGRALDRHGVPSKGRIRRRASQLKVKIPDLTDVNSID
Antibody Immunogen Description: Corresponds to amino acid residues V327-D450.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000), IHC (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.
Antibody Potency: Medium-weakDetects a ~55 kDa protein in cell and tissue lysates by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Chimpanzee | Rhesus macaque | Dog | Rat | Mouse.
Antibody Positive Control: 2 µg/ml of SMC-340 was sufficient for detection of Beta1 GABA receptor in 10 µg of rat brain lysate by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Antibody Cross Reactivity: No cross-reactivity against GABA-A-R-Beta 2 or –Beta3.
Related Product 1: GABA-A Receptor Alpha2 expression antibody (Cat. No.: AB-NN250-1)
Related Product 2: GABA-A Receptor Alpha4 expression antibody (Cat. No.: AB-NN251-1)
Related Product 3: GABA-A Receptor Alpha5 expression antibody (Cat. No.: AB-NN252-1)
Related Product 4: GABA-A Receptor Beta3 expression antibody (Cat. No.: AB-NN254-1)
Related Product 5: GABA-A Receptor Epsilon expression antibody (Cat. No.: AB-NN255-1)
Related Product 6: GABA-B Receptor 2 expression antibody (Cat. No.: AB-NN256-2)
Related Product 7: GABARAP expression antibody (Cat. No.: AB-NN257-1)
Related Product 8: GABARAP expression antibody (Cat. No.: AB-NN257-2)
Related Product 9: GABARAPL1 expression antibody (Cat. No.: AB-NN258-1)
Related Product 10: GABA B Receptor 1 expression antibody (Cat. No.: AB-NN259-1)
Scientific Background: GABRB1 is a beta subunit of the heteropentameric ligand-gated chloride channel gated by gamma-aminobutyric acid (GABA). GABA-gated chloride channels (GABA(A) receptors (GABAAR)), consist of five subunits arranged around a central pore and contain one or two GABA active binding sites located at the alpha and beta subunit interfaces, depending on subunit composition. The individual subunits of these receptors have similar sequences and structural features (1). GABA-A receptors are the major fast inhibitory neurotransmitter gated ion channels in the brain (2). When activated by GABA, GABAARs selectively allow the flow of chloride anions across the cell membrane. Beta-containing GABAARs can simultaneously bind GABA and histamine where histamine binds at the interface of two neighboring beta subunits, which has been implicatedthe regulation of sleep and wakefulness. It is found in the plasma membrane, dendrites, and synapse of neurons. Beta-1 containing GABAA receptors are found in regions controlling reward-related behavior, and their dysfunction can contribute to addictive behaviors. Mutations in GABRB1 are linked to Developmental and Epileptic Encephalopathy 45 (DEE45), a condition characterized by severe early-childhood epilepsy and cognitive impairment. GABRB1 expression is altered in the cerebellum of individuals with schizophrenia, bipolar disorder, and major depression, potentially affecting GABAergic signalling. This description may include information annotated by UniProt and/or Google AI.