Product Name:
GABA-A Receptor Alpha5
Product Number:
ab-nn252-1
Target Full Name: Gamma-aminobutyric acid receptor subunit alpha-5
Target Alias: Gamma-aminobutyric acid receptor subunit alpha-5; GABA(A) Receptor subunit Alpha-5; Gabra5
Product Type Specific: GABRA5 chloride channel pan-specific antibody
Antibody Code: NN252-1
Antibody Target Type: Pan-specific
Protein UniProt: P31644
Protein SigNET: GABA-A Receptor Alpha5
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with last cytoplasmic domain before extracellular C-terminus of human GABA-A Receptor Alpha5
Antibody Immunogen Sequence: VILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSEEKTSESKKTY
Antibody Immunogen Description: Corresponds to amino acid residues V368-Y419.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.1% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: In mouse brain lysates, this antibody detects a ~55 kDa protein by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rhesus macaque | Dog | Rat | Mouse.
Antibody Positive Control: A 1:100 dilution of SMC-494 was sufficient for detection of GABA-A R, Alpha5 in 20 µg of mouse brain lysate by ECL immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Antibody Cross Reactivity: Weak ~60 kDa protein that may be the target in mouse brain lysates. Does not cross-react with GABA-A Receptor Alpha2 or other GABA-A Receptors based on KO validation data.
Related Product 1: GABA-A Receptor Alpha2 expression antibody (Cat. No.: AB-NN250-1)
Related Product 2: GABA-A Receptor Alpha4 expression antibody (Cat. No.: AB-NN251-1)
Related Product 3: GABA-A Receptor Beta1 expression antibody (Cat. No.: AB-NN253-1)
Related Product 4: GABA-A Receptor Beta3 expression antibody (Cat. No.: AB-NN254-1)
Related Product 5: GABA-A Receptor Epsilon expression antibody (Cat. No.: AB-NN255-1)
Related Product 6: GABA-B Receptor 2 expression antibody (Cat. No.: AB-NN256-2)
Related Product 7: GABARAP expression antibody (Cat. No.: AB-NN257-1)
Related Product 8: GABARAP expression antibody (Cat. No.: AB-NN257-2)
Related Product 9: GABARAPL1 expression antibody (Cat. No.: AB-NN258-1)
Related Product 10: GABA B Receptor 1 expression antibody (Cat. No.: AB-NN259-1)
Scientific Background: GABRA5 is an alpha subunit of the heteropentameric ligand-gated chloride channel gated by gamma-aminobutyric acid (GABA). The GABA-A receptor is a member of the superfamily of fast acting ligand-gated ion channels. The individual subunits of these receptors have similar sequences and structural features (1). GABA-A receptors are the major fast inhibitory neurotransmitter gated ion channels in the brain (2). GABAARs containing alpha-5/GABRA5 subunits are mainly extrasynaptic and contribute to the tonic GABAergic inhibition in the hippocampus. Extrasynaptic alpha-5-containing GABAARs in CA1 pyramidal neurons have been implicated in learning and memory processes. Inverse agonists of the Alpha5 subunit may be useful in the treatment of Alzheimer's Disease (3). Mutations in GABRA5 are linked to early-onset epilepsy and developmental delays. It is also associated with autism, bipolar disorder, and schizophrenia.This description may include information annotated by UniProt and/or Google AI.