Product Name:
GABA-A Receptor Alpha2
Product Number:
ab-nn250-1
Target Full Name: Gamma-aminobutyric acid receptor subunit alpha-2
Target Alias: GABA A receptor subunit alpha 2; GABRA2; Gamma aminobutyric acid A receptor Alpha 2; GBRA2_Human
Product Type Specific: GRBRA2 chloride channel pan-specific antibody
Antibody Code: NN250-1
Antibody Target Type: Pan-specific
Protein UniProt: P47869
Protein SigNET: GABA-A Receptor Alpha2
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with cytoplasmic C-terminus of rat GABA-A Receptor Alpha2 (Uniprot ID P18508)
Antibody Immunogen Sequence: VEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIRPRS
Antibody Immunogen Description: Corresponds to amino acid residues V350-S385 .
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.1% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: In mouse brain lysates, this antibody weakly detects a ~55 kDa protein by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Rat | Mouse.
Antibody Positive Control: A 1:100 dilution of SMC-486 was sufficient for detection of GABA-A R, Alpha2 in 20 µg of mouse brain lysate by ECL immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Antibody Cross Reactivity: Does not cross-react with GABA-A Receptor Alpha1.
Related Product 1: GABA-A Receptor Alpha4 expression antibody (Cat. No.: AB-NN251-1)
Related Product 2: GABA-A Receptor Alpha5 expression antibody (Cat. No.: AB-NN252-1)
Related Product 3: GABA-A Receptor Beta1 expression antibody (Cat. No.: AB-NN253-1)
Related Product 4: GABA-A Receptor Beta3 expression antibody (Cat. No.: AB-NN254-1)
Related Product 5: GABA-A Receptor Epsilon expression antibody (Cat. No.: AB-NN255-1)
Related Product 6: GABA-B Receptor 2 expression antibody (Cat. No.: AB-NN256-2)
Related Product 7: GABARAP expression antibody (Cat. No.: AB-NN257-1)
Related Product 8: GABARAP expression antibody (Cat. No.: AB-NN257-2)
Related Product 9: GABARAPL1 expression antibody (Cat. No.: AB-NN258-1)
Related Product 10: GABA B Receptor 1 expression antibody (Cat. No.: AB-NN259-1)
Scientific Background: GABRA2 is an alpha subunit of the heteropentameric ligand-gated chloride channel gated by gamma-aminobutyric acid (GABA). The GABA-A receptor is a member of the superfamily of fast acting ligand-gated ion channels. When GABA binds, the receptor opens, allowing chloride ion influx, which inhibits neuron activity and reduces nervous transmission. The individual subunits of these receptors have similar sequences and structural features (1). GABA-A receptors are the major fast inhibitory neurotransmitter gated ion channels in the brain (2). The alpha-2 subunit exhibits synaptogenic activity together with beta-2 and very little to no activity together with beta-3. The gamma-2 is subunit necessary but not sufficient to induce rapid synaptic contacts formation. When GABA binds, the receptor opens, allowing chloride ion influx, which inhibits neuron activity and reduces nervous transmission. Genetic variants in GABRA2 are strongly associated with alcohol dependence, impulsivity, illicit drug dependence, and susceptibility to other behavioral disorders. This description may include information annotated by UniProt and/or Google AI.