Product Name:
SAP102
Product Number:
ab-nn238-1
Target Full Name: Disks large homologue 3
Target Alias: DLG3; MRX90; NEDLG; XLMR; PSD-95/SAP90-related protein 1; Synapse-associated protein 102; SAP-102
Product Type Specific: Synaptic protein pan-specific antibody
Antibody Code: NN238-1
Antibody Target Type: Pan-specific
Protein UniProt: Q92796
Protein SigNET: SAP102
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with N-terminus of rat SAP102 (Uniprot ID Q62936)
Antibody Immunogen Sequence: MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPSGGNGASSGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKNTPKLNGSGPSWWPECTCTNRDWYEQA
Antibody Immunogen Description: Corresponds to amino acid residues M1-A120 .
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | Immunoprecipitation
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: Medium-high potency. Detects a ~105 kDa protein in cell and tissue lysates by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rat | Mouse.
Antibody Positive Control: 1 µg/ml was sufficient for detection of Sap102 in 10 µg of rat brain lysate by colorimetric immunoblot analysis using Goat Anti-Mouse IgG:HRP as the secondary.
Antibody Specificity: High
Antibody Cross Reactivity: No cross-reactivity against PSD95, SAP97 or Chapsyn-110.
Scientific Background: Synapse-associated protein 102 belongs to the membrane-associated guanylate kinase protein family and is a homolog of the Drosophila dis large tumour suppressor protein. SAP102 has extensive sequence homology to the PSD 95 family of proteins that facilitate ion channel clustering at synaptic terminal (1, 2). SAP102 consists of three 90 amino acids PDZ domains at its amino terminus, a Src homology 3 domain and a guanylate kinase domain (3). All three PDZ domains of SAP102 participate in binding to the NMDA reception, interacting specifically with the carboxy-terminal domain of the N-methyl-D-aspartate receptor 2B (NR2B). The interaction may facilitate AMPA receptor withdrawal from the postsynaptic membrane by inhibiting the ERK/MAPK pathway (3, 4). SAP102 also interacts with synaptic ras-GTPase activating protein synGAP through its PDZ domains (3). In general, the SAP102 protein is more highly expressed in non-proliferating cells than in proliferating cells, indicating a role in the negative regulation of cell growth. This description may include information annotated by UniProt and/or Google AI.