Product Name:
BK Beta2
Product Number:
ab-nn219-1
Target Full Name: Calcium-activated potassium channel subunit beta-2
Target Alias: KCNMB2; BK channel subunit beta-2; BKbeta2; Calcium-activated potassium channel; subfamily M subunit beta-2; Charybdotoxin receptor subunit beta-2; K(VCA)beta-2; Maxi K channel subunit beta-2; Slo-beta-2
Product Type Specific: BK potassium channel pan-specific antibody
Antibody Code: NN219-1
Antibody Target Type: Pan-specific
Protein UniProt: Q9Y691
Protein SigNET: BK Beta2
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with N-terminus and C-terminus of mouse BKBeta2 (Uniprot ID Q9CZM9)
Antibody Immunogen Sequence: MFIWTSGRTSSSYRQDEKRNIYQKIRDHDLLDKRKTVTALK and. KLTQYLSLLCERIQRINR
Antibody Immunogen Description: Corresponds to amino acid residues M1-K41 and K218-235R.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence | Immunoprecipitation
Antibody Dilution Recommended: WB (1:1000), IHC (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.
Antibody Potency: High potency. Detects a ~27 kDa protein in cell and tissue lysates by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Dog | Rat | Mouse.
Antibody Positive Control: 1 µg/ml of SMC-331 was sufficient for detection of BK Channel beta2 in 10 µg of COS-1 cells transiently transfected with KBeta2 lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Antibody Cross Reactivity: No cross-reactivity against BKBeta1, BKBeta3 or BKBeta4.
Scientific Background: The BK-b2 subunit (encoded by the KCNMB2 gene) is an auxiliary protein that regulates the activity of large conductance, calcium-activated potassium (BK or MaxiK) channels. Unlike the b1-subunit, which predominantly shifts the voltage sensitivity of the channel, the b2 subunit is known for conferring rapid, N-type inactivation on the current. The b2-subunit causes BK channels to undergo rapid and complete inactivation, converting sustained BK currents into transient ones. BK channels contribute to electrical impulses, proper signal transmission of information and regulation of neurotransmitter release (1). The BK-b2 is a small transmembrane protein with two transmembrane segments, a large extracellular loop, and short intracellular N- and C-termini. The N-terminus (residues 1-17) is specifically responsible for the pore-blocking inactivation. It can exist as b2a (full length, inactivating) or b2b (a shorter variant with different properties). It is primarily expressed in the adrenal chromaffin cells, neuronal tissues, and smooth muscles. It modulates firing patterns in hippocampal CA1 neurons and adrenal chromaffin cells. It is involved in regulation of smooth muscle tone, specifically in tissues where quick inactivation of K+conductance is required. The b2b variant has been identified in the pancreas, where its modulation of BK channels may influence insulin secretion. A gain of function mutation in the pore-forming alpha subunit of the BK channel was linked to human neurological diseases. The distribution of the beta subunits in the brain can modulate the BK channels to contribute to the pathophysiology of epilepsy and dyskinesia (2). This description may include information annotated by UniProt and/or Google AI.

