Product Name:
ASIC1
Product Number:
ab-nn203-1
Target Full Name: Acid-sensing ion channel 1
Target Alias: ACCN2; Acid-sensing (proton-gated) ion channel; Acid-sensing ion channel 1; Amiloride-sensitive cation channel 2 neuronal; BNAC2; Brain sodium channel 2
Product Type Specific: Sodium channel pan-specific antibody
Antibody Code: NN203-1
Antibody Target Type: Pan-specific
Protein UniProt: P78348
Protein SigNET: ASIC1
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with cytoplasmic C-terminus of mouse ASIC1 (Uniprot ID Q6NXK8)
Antibody Immunogen Sequence: KHRLCRRGKCQKEAKRNSADKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC
Antibody Immunogen Description: Corresponds to amino acid residues K460-C526 .
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: Detects a ~60 kDa protein in cell and tissue lysates by Western blotting.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Chimpanzee | Dog | Rat | Mouse.
Antibody Positive Control: 1 µg/ml of SMC-427 was sufficient for detection of ASIC1 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Scientific Background: Acid sensing ion channel ASIC1 (ACCN2, BNAC2 and ASIC1a) is a proton-gated, trimeric cation channel, that is widely expressed in the central nervous system, and acts as a pH sensor, translating extracellular acidosis into excitatory sodium (Na+) and calcium (Ca2+) currents. It plays critical roles in pain transduction, learning, memory, and fear, and contributes to neuronal damage during stroke. As part of the DEG/ENaC superfamily, it forms a trimeric membrane protein with two transmembrane domains, short intracellular termini, and a large extracellular domain that binds protons. It interacts with proteins like PICK1, which helps regulate its surface expression and synaptic localization. It is activated by a decrease in extracellular pH (acidosis), producing fast, transient inward currents. ASIC1 is most abundant in the dorsal root ganglia, main olfactory bulb, cerebral cortex, hippocampal formation, habenula, basolateral amygdaloid nuclei, putamen, nucleus accumbens, and cerebellum of the rat brain. This description may include information annotated by UniProt and/or Google AI.