Product Name:
AMIGO-1
Product Number:
ab-nn193-1
Target Full Name: Amphoterin-induced protein 1
Target Alias: AMIGO 1; AMIGO1; Adhesion molecule with Ig like domain 1; Alivin-2; Alivin 2; Ali2; AMIGO; KIAA1163; Amphoterin induced gene and ORF (Amigo); Amphoterin induced protein 1; MGC25558; OTTHUMP00000013379; RP23 89M15.6
Product Type Specific: Adhesion protein pan-specific antibody
Antibody Code: NN193-1
Antibody Target Type: Pan-specific
Protein UniProt: Q86WK6
Protein SigNET: AMIGO
Antibody Type: Monoclonal
Antibody Host Species: Mouse
Antibody Ig Isotype Clone: IgG1
Antibody Immunogen Source: Fusion protein with cytoplasmic C-terminus of human AMIGO-1
Antibody Immunogen Sequence: TPCRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPESVSSVFSDTPIVV
Antibody Immunogen Description: Corresponds to amino acid residues T394-V492.
Production Method: Protein G purified
Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.
Antibody Concentration: 1 mg/ml
Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide
Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.
Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence
Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.
Antibody Potency: In mouse brain lysates, this antibody detects a ~60-80 kDa protein depending on maturity/glycosylation.
Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rat | Mouse.
Antibody Positive Control: 1 µg/ml of SMC-438 was sufficient for detection of AMIGO-1 in 20 µg of rat brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.
Antibody Specificity: Very high
Scientific Background: The amphoterin-induced gene and ORF (AMIGO) family of proteins consists of AMIGO1, AMIGO2 and AMIGO3. All three members are single pass type I membrane proteins that contain several leucine-rich repeats, one IgG domain and a transmembrane domain. The AMIGO proteins are specifically expressed on fiber tracts of neuronal tissues and participate in their formation. They can form complexes with each other, but can also self-bind. AMIGO1, also designated Alivin2, promotes growth and fasciculation of neurites and plays a role in myelination and fasciculation of developing neural axons. In cerebellar neurons, AMIGO2 (Alivin1) is crucial for depolarization-dependent survival. Similar to AMIGO1 and AMIGO2, AMIGO3 (Alivin3) plays a role in hemophilic and/or heterophilic cell-cell interaction and signal transduction. This description may include information annotated by UniProt and/or Google AI.

