Product Name:

AMIGO-1


Product Number:

ab-nn193-1

Price:

Regular price
$105.00
Regular price
Sale price
$105.00

Download Product PDF

Target Full Name: Amphoterin-induced protein 1

Target Alias: AMIGO 1; AMIGO1; Adhesion molecule with Ig like domain 1; Alivin-2; Alivin 2; Ali2; AMIGO; KIAA1163; Amphoterin induced gene and ORF (Amigo); Amphoterin induced protein 1; MGC25558; OTTHUMP00000013379; RP23 89M15.6

Product Type Specific: Adhesion protein pan-specific antibody

Antibody Code: NN193-1

Antibody Target Type: Pan-specific

Protein UniProt: Q86WK6

Protein SigNET: AMIGO

Antibody Type: Monoclonal

Antibody Host Species: Mouse

Antibody Ig Isotype Clone: IgG1

Antibody Immunogen Source: Fusion protein with cytoplasmic C-terminus of human AMIGO-1

Antibody Immunogen Sequence: TPCRCWCRGVEKPSSHQGDSLSSSMLSTTPNHDPMAGGDKDDGFDRRVAFLEPAGPGQGQNGKLKPGNTLPVPEATGKGQRRMSDPESVSSVFSDTPIVV

Antibody Immunogen Description: Corresponds to amino acid residues T394-V492.

Production Method: Protein G purified

Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.

Antibody Concentration: 1 mg/ml

Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide

Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.

Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence

Antibody Dilution Recommended: WB (1:1000); optimal dilutions for assays should be determined by the user.

Antibody Potency: In mouse brain lysates, this antibody detects a ~60-80 kDa protein depending on maturity/glycosylation.

Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rat | Mouse.

Antibody Positive Control: 1 µg/ml of SMC-438 was sufficient for detection of AMIGO-1 in 20 µg of rat brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary antibody.

Antibody Specificity: Very high

Scientific Background: The amphoterin-induced gene and ORF (AMIGO) family of proteins consists of AMIGO1, AMIGO2 and AMIGO3. All three members are single pass type I membrane proteins that contain several leucine-rich repeats, one IgG domain and a transmembrane domain. The AMIGO proteins are specifically expressed on fiber tracts of neuronal tissues and participate in their formation. They can form complexes with each other, but can also self-bind. AMIGO1, also designated Alivin2, promotes growth and fasciculation of neurites and plays a role in myelination and fasciculation of developing neural axons. In cerebellar neurons, AMIGO2 (Alivin1) is crucial for depolarization-dependent survival. Similar to AMIGO1 and AMIGO2, AMIGO3 (Alivin3) plays a role in hemophilic and/or heterophilic cell-cell interaction and signal transduction. This description may include information annotated by UniProt and/or Google AI.