Product Name:

ADAM22 (cytoplasmic)


Product Number:

ab-nn189-1

Price:

Regular price
$105.00
Regular price
Sale price
$105.00

Download Product PDF

Target Full Name: Disintegrin and metalloproteinase domain-containing protein 22

Target Alias: MDC2; Metalloproteinase disintegrin ADAM22-3; Metalloproteinase-like disintegrin-like and cysteine-rich protein 2; ADAM 22; ADAM metallopeptidase domain 22; MGC149832

Product Type Specific: Metalloproteinase pan-specific antibody

Antibody Code: NN189-1

Antibody Target Type: Pan-specific

Protein UniProt: Q9P0K1

Protein SigNET: ADAM22 (cytoplasmic)

Antibody Type: Monoclonal

Antibody Host Species: Mouse

Antibody Ig Isotype Clone: IgG2B

Antibody Immunogen Source: Fusion protein with cytoplasmic region of mouse ADAM22

Antibody Immunogen Sequence: GYKNYREQRQLPQGDYVKKPGDGDSFYSDFPPGGSTNSASSSKKRSNGLSHSWSERIPDTKHISDICENGRPRSNSWQGNMGGNKKKIRGKRFRPRSNSTE

Antibody Immunogen Description: Corresponds to amino acid residues G757-E857 .

Production Method: Protein G purified

Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.

Antibody Concentration: 1 mg/ml

Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide

Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.

Product Use: Western blotting | Immunohistochemistry | Immunoprecipitation

Antibody Dilution Recommended: WB (1:1000), IHC (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.

Antibody Potency: Detects a the cytoplasmic domain of ADAM22 ~90 kDa protein in cell and tissue lysates by Western blotting. Weak human detection.

Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Rat | Mouse.

Antibody Positive Control: 1 µg/ml of SMC-411 was sufficient for detection ofADAM22 in 10 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.

Scientific Background: ADAM 22 belongs to the ADAM gene family which have been shown to bind integrin and therefore may have a part in cell to cell or cell to matrix interactions. ADAM 22 is unique ias it is only observed in the nervous system and predominantly in the brain. ADAM 22 is attached by cytoskeletal scaffolds to the postsynaptic density and it acts as the receptor for LGI1 (Leucine-rich glioma-inactivated 1) in the brain, forming a trans-synaptic complex. This complex helps regulate excitatory neurotransmission and synaptic strength. It also serves as the receptor for LGI4, which is crucial for Schwann cell differentiation and proper myelination in the peripheral nervous system. It is a "pseudo-metalloprotease" that functions primarily as a binding partner or receptor. Unlike other ADAM family members, ADAM 22 lacks the necessary zinc-binding motif to act as a protease. This description may include information annotated by UniProt and/or Google AI.