Product Name:

HO1


Product Number:

ab-nn052-4

Price:

Regular price
$105.00
Regular price
Sale price
$105.00

Download Product PDF

Target Full Name: Heme oxygenase 1

Target Alias: HSP32; HMOX1; HO; HO1

Product Type Specific: Heme oxygenase pan-specific antibody

Antibody Code: NN052-4

Antibody Target Type: Pan-specific

Protein UniProt: P09601

Protein SigNET: HO1

Antibody Type: Monoclonal

Antibody Host Species: Mouse

Antibody Ig Isotype Clone: IgG1 Kappa

Antibody Immunogen Source: Human HO-1 Synthetic peptide patterned after N-terminus

Antibody Immunogen Sequence: MERPQPDSMPQDLSEALKEATKEVHTQAEN

Antibody Immunogen Description: Corresponds to amino acid residues M1-N30.

Production Method: Protein G purified

Antibody Modification: Unconjugated. Contact KInexus if you are interest in having the antibody biotinylated or coupled with fluorescent dyes.

Antibody Concentration: 1 mg/ml

Storage Buffer: Phosphate buffered saline pH7.4, 50% glycerol, 0.09% sodium azide

Storage Conditions: For long term storage, keep frozen at -40°C or lower. Stock solution can be kept at +4°C for more than 3 months. Avoid repeated freeze-thaw cycles.

Product Use: Western blotting | Immunohistochemistry | ICC/Immunofluorescence | Immunoprecipitation | ELISA

Antibody Dilution Recommended: WB (1:1000), IHC (1:100), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.

Antibody Potency: Medium potency. Detects a ~32 kDa protein in cell and tissue lysates by Western blotting.

Antibody Species Reactivity: This antibody detects the target protein in the following species due to conservation of amino acid sequence: Human | Monkey | Cow | Pig | Dog | Rabbit | Guinea pig | Rat | Mouse | Hamster.

Antibody Positive Control: 1 µg/ml was sufficient for detection of HO-1 in 10 µg of mixed human cell line lysate by colorimetric immunoblot analysis using Goat Anti-Mouse IgG:HRP as the secondary.

Antibody Specificity: Medium-low

Antibody Cross Reactivity: Does not cross-react with HO-2.

Scientific Background: Heme-oxygenase is a ubiquitous enzyme that catalyzes the initial and rate-limiting steps in heme catabolism yielding equimolar amounts of biliverdin, iron and carbon monoxide. Biliverdin is subsequently converted to bilirubin and the free iron is sequestered to ferritin (1). These products have important physiological effects as carbon monoxide is a potent vasodilator; biliverdin and bilirubin are potent antioxidants; and the free iron increases oxidative stress and regulates the expression of many mRNAs (2). There are three isoforms of heme-oxygenase, HO-1, HO-2 and HO-3; however HO-1 and HO-2 are the major isoforms as they both have been identified in mammals (3). HO-1, also known as heat shock protein 32, is an inducible isoform activated by most oxidative stress inducers, cytokines, inflammatory agents and heat shock. HO-2 is a constitutive isoform which is expressed under homeostatic conditions. HO-1 is also considered to be a cytoprotective factor in that free heme is highly reactive and cytotoxic, and secondly, carbon monoxide is a mediator inhibiting the inflammatory process and bilirubin is a scavenger for reactive oxygen, both of which are the end products of heme catalyzation (4). It has also been shown that HO-1 deficiency may cause reduced stress defense, a pro-inflammatory tendency (5), susceptibility to atherosclerotic lesion formation (6), endothelial cell injury, and growth retardation (7). Up-regulation of HO-1 appears to be one of the major defense mechanisms of oxidative stress (4). This description may include information annotated by UniProt and/or Google AI.